전체 글517 [Reed Biotech] Mouse IL-12 p40(Interleukin 12 p40) ELISA Kit [Reed Biotech] Mouse IL-12 p40(Interleukin 12 p40) ELISA Kit Catalog Number：RE1076M Product NameMouse IL-12 p40(Interleukin 12 p40) ELISA KitSpeciesMouseUniprot IDP43432Alternative NamesCLMF p40; CLMF; CLMF2; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL12 p40; IL-12 p40; IL-12 subunit p40; IL12B; IL-12B; IL-12BNK cell stimulatory factor chain 2; interleukin 12, p40; interleukin 12B .. 2025. 1. 13. [Top Membrane] Microporous organic membrane [Top Membrane] Microporous organic membraneThe ideal microporous membranes is supposed to have uniform pores, which are critical to the precise control of industry processes, such as filtration, separation, purification and material preparation. This kind of membrane has wide applications in the fields of chemical industry, medicine, biopharmaceuticals, quality control and water treatment. Howev.. 2025. 1. 9. [Affigen] AffiCLONE® Universal One Step Cloning Kit [Affigen] AffiCLONE® Universal One Step Cloning KitSKU: AFG-YSN-179Hieff Clone™ Universal One Step Cloning Kit is a simple, fast, and highly efficient cloning technology and enables directional insertion of any amplified DNA product into any linearized vector at any site. Firstly, the vector is linearized at the cloning site. A small sequence overlapped with each end of the cloning site is added.. 2025. 1. 6. [LabBioreagents] Adalimumab ELISA Kit [LabBioreagents] Adalimumab ELISA KitCatalog No.: AEK-01-1220Adalimumab (Human) ELISA KitCatalog Number: AEK-01-1220Size: 1 plate (96 wells)Adalimumab ELISA Kit is a sandwich enzyme-linked immunoassay for the quantitative determination of Adaliumab with high sensitivity and specificity in serum and plasma.Kit PerformanceSensitivity: 25 ng/mLAssay Range: 25 – 2000 ng/mLCross-reactivity: There is .. 2025. 1. 2. [Membrane Solutions] Nylon Mesh Filter [Membrane Solutions] Nylon Mesh FilterDescription：Nylon Mesh Filter, Size:25mm, Pore Size:30μmPackaging：200(pcs)#MembraneSolutions #NylonMeshFilter #MeshFilter 2025. 1. 2. [Calixar] Ion Channels [Calixar] Ion ChannelsTargetDescription hKCC2CALIXAR’s Solute carrier family 12 member 5 (hKCC2) facilitates reliable fragment-based drug design (FBDD), structure-based drug discovery (SBDD), and antibody discovery against this specific target. Product highlights High Purity: Our products are rigorously purified and quality-controlled to meet the highest standards. Biological Activity: We provi.. 2024. 12. 30. [CellPro] CyrunFeh® Separating gel coagulation tube [CellPro] CyrunFeh® Separating gel coagulation tubeProduct TypeItem No.Additives TypeSpecifications (Suction Volume)Pipe body sizeHead cover colorPackagingSeparating gel coagulation tube340135coagulant separating gel3.5mL13X75mmDark yellow100 PCs/pallet, 1000 PCs/carton340150coagulant separating gel5.0mL13X100mmDark yellow100 PCs/pallet, 1000 PCs/carton CellProBio Separating gel coagulation tube.. 2024. 12. 28. [GlycoNZ] GlcAβ-sp3-biot [GlycoNZ] GlcAβ-sp3-biot 0012-BMGlcAβ-C3-biotβ-glucuronate-BMBM-SeriesMonosaccharideMonomeric 2024. 12. 23. [InRedox] ATO Films on Ti Foil [InRedox] ATO Films on Ti FoilSKU: AAOThe general range of AAO geometries and specifications for our standard stock products.ParameterAvailable Range *Standard Specifications (stock products)Nanotube Diameter, nm15 – 75050, 100, 150, 300, 500 (±10% + 2)Size, mm (in)5 – 200 (1/8″ – 8″)10 mm and 25 mm OD round; 10 mm x 10 mm and 25 mm x 25 mm squareShapeanyround or square ATO Thickness (Nanotube .. 2024. 12. 18. [UbiQ] Ub-FP [UbiQ] Ub-FPcode UbiQ-012Category activity assay reagents UbiQ-012 (Ub-FP) is a fluorescence polarization assay reagent which is based on a 5-carboxytetramethylrhodamine (TAMRA) modified Lys-Gly sequence that is linked to ubiquitin via a native isopeptide bond with the lysine side-chain. Typical substrate concentrations range from 10−100 nM. DUB concentrations can range from 0.01-10 nM but depe.. 2024. 12. 17. [ACS Material] Double-Pass AAO (5p/Pack) [ACS Material] Double-Pass AAO (5p/Pack)SKU# A2010011 CAS No.: 1344-28-1Types of Double-Pass AAO TemplatesSKUApertureHole DepthHole Cycle(Interpore distance)Circular (DIA)A201001150nm50-70µm110nm1.2 cmA202001170nm50-70µm110nm1.2 cmA203001190nm50-70µm110nm1.2 cmA2041011200nm50-70µm450nm1.2 cmA2051011300nm50-70µm450nm1.2 cmA2061011400nm50-70µm450nm1.2 cmA201002150nm50-70µm110nm2.5 cmA202002170nm50.. 2024. 12. 16. [Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-TagSKU: P2020-176_100 Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Species: Serratia marcescensTags: His-tag, N-terminalSequence without tags (AA 22-266):MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN.. 2024. 12. 10. 이전 1 2 3 4 5 6 7 8 ··· 44 다음
