전체 글506 [Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-TagSKU: P2020-176_100 Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Species: Serratia marcescensTags: His-tag, N-terminalSequence without tags (AA 22-266):MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN.. 2024. 12. 10. [Syringa lab Supplies] Falcon Centrifuge Tubes 15 mL with Cross-Cut Septa Caps [Syringa lab Supplies] Falcon Centrifuge Tubes 15 mL with Cross-Cut Septa CapsSKU:1F711 15 mL Cross Cut SeptaSecure non-PTFE septa caps with Falcon Centrifuge Tubes, Pack of 25 (non-sterile)Product OverviewIntroducing the 15 mL Falcon Centrifuge Tubes with SeptaSecure caps. This pack of 25 non-sterile Falcon Tubes is perfectly sized for smaller volume requirements and offers the same innovative .. 2024. 12. 4. [Reed Biotech] EYFP Rabbit Polyclonal Antibody [Reed Biotech] EYFP Rabbit Polyclonal Antibody Catalog Number:RA20406 Product NameEYFP Rabbit Polyclonal AntibodySpeciesN/AApplicationsWB, IHC, IF, IPConditionPBS, pH 7.4, containing 0.02% sodium azide as Preservative and 50% Glycerol.Alternative NamesYellow florescent protein, Enhanced Yellow florescent protein, EYFP, YFPStore-20°C. Do not aliquot the antibody.Recommended dilutionsWB: 1:3,000.. 2024. 11. 29. [CellPro] CellProBio 15ml 50ml Polypropylene Centrifuge Tubes [CellPro] CellProBio 15ml 50ml Polypropylene Centrifuge TubesSpecifications:P/NCapacityTube ColorDescriptionConfiguration80115115 mLClearBulk, Sterile25 tubes/pack, 20 packs/case801152P0115 mLClearRack Packed, Sterile25 tubes/rack, 20 racks/case80115615 mLAmberBulk, Sterile25 tubes/pack, 20 packs/case80150150 mLClearBulk, Sterile25 tubes/pack, 20 packs/case801502P0150 mLClearRack Packed, Sterile.. 2024. 11. 27. [Nanocs] Graphene oxide, solid [Nanocs] Graphene oxide, solidCat. No.GO1-25MG / 25mg Nanocs provides various single layer graphene and graphene oxide products for your research use. These graphene products have been processed with multi step chemical and physical processes to ensure high quality.Nanocs also provides various surface modified graphene and graphene oxide products with a wide range of specifications to suit diffe.. 2024. 11. 15. [VeritasInnovation] Fetal Calf Whole Blood [VeritasInnovation] Fetal Calf Whole BloodFetal Calf Whole Blood is a highly valuable specimen collected from bovine fetuses, known for its rich stem cell content and unique cellular properties. It serves as an indispensable tool in scientific research, particularly for developmental studies, cellular biology, and in the creation of serum and media supplements for cell culture. Intended Use and.. 2024. 11. 11. [UbiQ] TAMRA-Ub [UbiQ] TAMRA-Ub code UbiQ-003Category ubiquitin(-like) proteins TAMRA-Ub (UbiQ-003) is fluorescent ubiquitin labeled on the N-terminus with TAMRA (5- tetramethylrhodamine, exc 550 nm, emi 590 nm). It has been prepared by total chemical synthesis and allows detection of ubiquitylation by in-gel fluorescence. This direct and more sensitive read-out gives more distinct labeling patterns than immu.. 2024. 10. 23. [Iris Biotech] PP58 [Iris Biotech] PP58 Chemical name: 2-[4-(2-Amino-ethoxy)-phenylamino]-6-(2,6-dichloro-phenyl)-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-oneProduct code:LS-4090CAS No.:212391-58-7Formula:C22H19Cl2N5O2Molecular weight:456.32 g/mol PP58 is a pyrido[2,3-d]pyrimidine-based compound that inhibits PDGFR, FGFR and Src family activities with nanomolar IC50 values. 2024. 10. 16. [VeritasInnovation] HA1010: Human Serum Albumin, Lyophilized, Low B12 and Folate [VeritasInnovation] HA1010: Human Serum Albumin, Lyophilized, Low B12 and Folate Our Human Serum Albumin, Lyophilized, Low B12 and Folate, is a precision-engineered product specifically designed for research and diagnostic applications requiring minimal interference from vitamins B12 and folate.This albumin is carefully processed and lyophilized to ensure the preservation of protein structure .. 2024. 10. 11. [IntactGenomics] ig® 5-alpha Chemically Competent Cells [IntactGenomics] ig® 5-alpha Chemically Competent Cells DescriptionIntact Genomics 5-alpha chemically competent E. coli cells are suitable for high efficiency transformation in a wide variety of applications such as cloning and sub-cloning. ig® 5-alpha chemically competent cells are at least twice the transformation efficiency of the nearest competitor.SpecificationsCompetent cell type: Chemic.. 2024. 10. 4. [ACS Material] SBA-15 [ACS Material] SBA-15 SKU# MSB15011 Santa Barbara Amorphous-15 (SBA-15) is a highly stable mesoporous silica sieve developed by researchers at the University of California at Santa Barbara. It gets it high hydrothermal and mechanical stability from a framework of uniform hexagonal pores that feature a narrow pore-size distribution and a tunable pore diameter of 5nm to 15nm, but, most significa.. 2024. 9. 30. [Nanocs] Polystyrene latex beads, aqueous suspension [Nanocs] Polystyrene latex beads, aqueous suspension Cat. No.PS01-100-1Specification100 nmUnit Size1 mLPolystyrene Particles from Nanocs have narrow size distribution yet with multiple size selection from 20 nm to 10 microns. These particles are suspended in 1% aqeuous solution. Standard deviation of these particles is in the range of 10% of listed size parameter. These particles have wide appl.. 2024. 9. 27. 이전 1 2 3 4 5 6 7 8 ··· 43 다음