본문 바로가기

trenzyme13

[Trenzyme] Cystatin C, His-Tag [Trenzyme] Cystatin C, His-TagSKU: P2020-186_100 Product Name: Cystatin C, His-TagCatalog No.: P2020-186RefSeq Links: HGNC:2475; NX_P01034; NP_000090.1; NM_000099.3; NP_001275543.1; NP_001275543.1NM_001288614.1; PDBe 3sva; UniProt: P01034Synonyms: Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin Cystatin C is a small, non-glycosylated protein that acts as a potent .. 2025. 9. 24.
[Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-Tag SKU: P2020-176_100Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Expression Host: E. coliFormulation: 20 mM Tris, 20 mM NaCl, 2 mM MgCl2, 50 % Glycerol; pH 8.0Format: Liquid, stored and shipped at -20° CPurity: > 95 % as determined .. 2025. 7. 11.
[Trenzyme] human Cadherin-17 [Trenzyme] human Cadherin-17SKU: P2020-178_100Product Name: human Cadherin-17, MBP/His-Tag Catalog No.: P2020-178 RefSeq Links: HGNC:1756; NX_Q12864; NP_001138135.1; NM_004063.3; PDBe 7cym; UniProt: Q12864Synonyms: CDH17, Liver-intestine cadherin, LI-cadherin, Intestinal peptide-associated transporter HPT-1Species: Homo sapiensTags: MBP/His-tag, N-terminal Sequence without tags (AA 23-787):MQEGK.. 2025. 1. 20.
[Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-TagSKU: P2020-176_100 Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Species: Serratia marcescensTags: His-tag, N-terminalSequence without tags (AA 22-266):MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN.. 2024. 12. 10.
[Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme]  Biotinylated hACE2 Protein (ECD), Avi/His-TagSKU: P2020-017Product Name: Biotinylated hACE2 Protein (ECD), Avi/His-TagCatalog No.: P2020-017RefSeq Links: UniProt: Q9BYF1Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15; biotinylated hACE2Expression Host: human, HEK293Formulation: .. 2024. 5. 29.
[Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated [Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated SKU: P2020-037 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 90% as determined by SDS-PAGE Product Name: hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated Catalog No.: P2020-037 RefSeq Links: UniProt: Q9BYF1 Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; A.. 2024. 2. 21.
[Trenzyme] CHO-K1 human XCR1 [Trenzyme] CHO-K1 human XCR1 SKU: C2021-002 Product Name: CHO-K1 human XCR1 Catalog No.: C2021-002 Tube Label: CHO-K1 stably expressing hXCR1 Target: human XCR1 Parental Cell Line: CHO-K1 Organism: C. griseus Tissue: ovary Morphology: epithelial-like Mycoplasma Test: negative (provided by Eurofins Genomics) Biosafety Level: 1 Culture properties: adherent 2024. 1. 15.
[Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag SKU: P2020-017 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 80% as determined by SDS-PAGE Sequence Information Species: Homo sapiens, human Tags: Avi/His-Tag, C-terminal Sequence without tags (AA 20-707): MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEI.. 2023. 11. 16.
[Trenzyme] pro-TGF-beta 1, GFP/His-Tag SKU: P2020-118 Product Name: pro-TGF-beta 1, GFP/His-Tag Catalog No.: P2020-118 RefSeq Links: UniProt: P01137; NP_000651.3; NM_000660.6; PDB: 1KLA Synonyms: Latent TGF‑β1, small latent TGF-β1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-β1 Expression Host: human, HEK293 Formulation: PBS; pH 7.4. Format: Liquid, stored a.. 2023. 10. 13.
[Trenzyme] B7-H3 Protein, Human [Trenzyme] B7-H3 Protein, Human Product Name: B7-H3 Protein, Human Catalog No.: P2020-002 RefSeq Links: UniProt: Q5ZPR3-2 Synonyms: B7-H3 Protein, Human; B7H3 Protein, Human; B7RP-2 Protein; CD276 Recombinant protein containing the extracellular domain (ECD) of human CD276, Isoform 2 with C-terminal His-Tag. 2023. 9. 7.
[trenzyme] HEK-F Orco M.musculus Lactadherin [trenzyme] HEK-F Orco M.musculus Lactadherin SKU: C2021-005 Overview Product Name: HEK-F Orco M.musculus Lactadherin Catalog No.: C2021-005 Tube Label: HEK-F stably expressing Mfge8-D89 Product Information Target: M. musculus Lactadherin (uniprot P21956), D89E linker, C-terminal His-tag Parental Cell Line: HEK-F Organism: H. sapiens Tissue: embryonal kidney Mycoplasma Test: negative (provided by.. 2023. 8. 28.
[Trenzyme] hGuanylatekinase, His-Tag [Trenzyme] hGuanylatekinase, His-Tag SKU: P2020-107 Overview Product Name: hGuanylatekinase, His-Tag Catalog No.: P2020-107 RefSeq Links: UniProt: Q16774 Synonyms: guanosine monophosphate kinase; GMK; GMPK; Guanylate kinase; GUK1; hGMPK; human Guanylate kinase; GMP Kinase The transformation process of cellular guanosine monophosphate kinase (GMP) into guanosine monophosphate kinase (GDP) is perf.. 2023. 8. 21.

티스토리툴바