본문 바로가기

P20207

[Trenzyme] Cystatin C, His-Tag [Trenzyme] Cystatin C, His-TagSKU: P2020-186_100 Product Name: Cystatin C, His-TagCatalog No.: P2020-186RefSeq Links: HGNC:2475; NX_P01034; NP_000090.1; NM_000099.3; NP_001275543.1; NP_001275543.1NM_001288614.1; PDBe 3sva; UniProt: P01034Synonyms: Cystatin-3; Gamma-trace; Neuroendocrine basic polypeptide; Post-gamma-globulin Cystatin C is a small, non-glycosylated protein that acts as a potent .. 2025. 9. 24.
[Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-Tag SKU: P2020-176_100Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Expression Host: E. coliFormulation: 20 mM Tris, 20 mM NaCl, 2 mM MgCl2, 50 % Glycerol; pH 8.0Format: Liquid, stored and shipped at -20° CPurity: > 95 % as determined .. 2025. 7. 11.
[Trenzyme] human Cadherin-17 [Trenzyme] human Cadherin-17SKU: P2020-178_100Product Name: human Cadherin-17, MBP/His-Tag Catalog No.: P2020-178 RefSeq Links: HGNC:1756; NX_Q12864; NP_001138135.1; NM_004063.3; PDBe 7cym; UniProt: Q12864Synonyms: CDH17, Liver-intestine cadherin, LI-cadherin, Intestinal peptide-associated transporter HPT-1Species: Homo sapiensTags: MBP/His-tag, N-terminal Sequence without tags (AA 23-787):MQEGK.. 2025. 1. 20.
[Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-TagSKU: P2020-176_100 Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Species: Serratia marcescensTags: His-tag, N-terminalSequence without tags (AA 22-266):MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN.. 2024. 12. 10.
[Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated [Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated SKU: P2020-037 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 90% as determined by SDS-PAGE Product Name: hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated Catalog No.: P2020-037 RefSeq Links: UniProt: Q9BYF1 Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; A.. 2024. 2. 21.
[Trenzyme] pro-TGF-beta 1, GFP/His-Tag SKU: P2020-118 Product Name: pro-TGF-beta 1, GFP/His-Tag Catalog No.: P2020-118 RefSeq Links: UniProt: P01137; NP_000651.3; NM_000660.6; PDB: 1KLA Synonyms: Latent TGF‑β1, small latent TGF-β1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-β1 Expression Host: human, HEK293 Formulation: PBS; pH 7.4. Format: Liquid, stored a.. 2023. 10. 13.
[Trenzyme] greenTEV Cleavage Kit [Trenzyme] greenTEV Cleavage Kit SKU: P2020-CK1 Including 1 x greenTEV (P2020-142) 1 x Cleavage and tag control protein (P2020-141) Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein. TEV cleavage results in two cleavage products of 42.8 kDa and 47.7 kDa. The optimized greenTEV protease and the Cleavage and tag contro.. 2023. 8. 18.