본문 바로가기

전체 글451

[Genaxxon Bioscience] [Ala9] Autocamtide 2 - KKALRRQEAVDAL [Genaxxon Bioscience] [Ala9] Autocamtide 2 - KKALRRQEAVDAL Order number: P2358.9501 Shipping: Shipment: not cooled. Store at -20°C. For laboratory usage only! Specifications: Purity: >95% (HPLC) Sequence: KKALRRQEAVDAL lyophilized white powder 2023. 12. 4.
[Calixar] Adenosine receptor A2A - Class A GPCR [Calixar] Adenosine receptor A2A - Class A GPCR Target name: Adenosine receptor A2A (A2AR) Gene: ADORA2A Uniprot Accession: P29274 Origin: Human (Homo sapiens) Class: Class A GPCR Sequence: Full-length, wild type sequence, with a N-terminus Strep tag II, 8xHis-tag, and TEV protease cleavage site. Affinity Tag: His/Strep (both N-terminal) Catalogue number: PP1 Theor. MW: 47,7kDa Shipment temperat.. 2023. 11. 30.
[MuseChem] Deoxycholic Acid - CAS 83-44-3 [MuseChem] Deoxycholic Acid - CAS 83-44-3 Catalog Number: A000020 CAS Number: 83-44-3 PubChem Substance ID:355159722 Molecular Formula: C24H40O4 Molecular Weight:392.58 Purity: ≥95% Deoxycholic acid, also known as deoxycholate, cholanoic acid, and 3α,12α-dihydroxy-5β-cholanate, is a bile acid. Deoxycholic acid is one of the secondary bile acids, which are metabolic byproducts of intestinal bacte.. 2023. 11. 29.
[Nanografi] Graphitic Carbon Nitride (g-C3N4) Powder 1-10 μm [Nanografi] Graphitic Carbon Nitride (g-C3N4) Powder 1-10 μm SKU:NG10MPW1236 Carbon nitride, also known as graphitic carbon nitride (g-C3N4), is a two-dimensional material composed of carbon and nitrogen atoms that are arranged in a hexagonal lattice structure, similar to graphene. Carbon nitride is relatively stable, lightweight, and has a high surface area, making it an excellent candidate for.. 2023. 11. 27.
[Reed Biotech] Human MMP-9(Matrix Metalloproteinase 9) ELISA Kit [Reed Biotech] Human MMP-9(Matrix Metalloproteinase 9) ELISA Kit Catalog Number：RE2796H Product Name Human MMP-9(Matrix Metalloproteinase 9) ELISA Kit Species Human Uniprot ID P14780 Alternative Names MMP9, CLG4B,Gelatinase B, GELB, MANDP2, 92kDa Type IV Collagenase, 92 KDa Gelatinase Detection metho Sandwich Sensitivity 0.05 ng/mL Standard 10ng/mL Detection Range 0.16-10ng/mL Sample type Serum,.. 2023. 11. 24.
[Calixar] CALIXAR™ C2B Kit [Calixar] CALIXAR™ C2B Kit Compound name: CALIXAR™ C2B Additive Kit Catalogue number: MD1-109 Stabilizing Surfacants: Calixarenes1-5, fluorinated poly(tris)6-8, bis-glucose9-11 Chemical structures: LC001, LC002, LC021, LC036, LC037, LC038, LC039, CALX004SFO, CALX113ACE, CALX163ACE MW: 2130 – 963.7 (g/mol) Theor. MW: 0.0170 – 0.0558 (g) Production µL: MD1- 109 is presented as a 10 x 50 µL microfu.. 2023. 11. 23.
[Profacgen] Recombinant E. coli gldA Protein (His tag) (EE1012GS) [Profacgen] Recombinant E. coli gldA Protein (His tag) (EE1012GS) Cat.No. EE1012GS Synonyms gldA; glycerol dehydrogenase, NAD+ dependent; 1,2-propanediol:NAD+ oxidoreductase; ECK3937; JW5556 Species E. coli Accession gldA Source E. coli Tag His Form Liquid. In Phosphate buffered saline (pH7.4), 10% glycerol Molecular Mass 41.1 kDa Protein length 1-367aa AA Sequence MGSSHHHHHH SSGLVPRGSH MGSMDRII.. 2023. 11. 22.
[NanoCym] SILOCYM™ Red – Fluorescent Silica [NanoCym] SILOCYM™ Red – Fluorescent Silica SILOCYM-Red consists of ultra-monodisperse, spherical silica nanoparticles that are loaded with a fluorescent dye. Typically it is used in biosensing, labeling and bioimaging-related applications and exhibits a red fluorescence with excitation/emission of 570nm and 590nm respectively. Please select from the diameters listed below. If you’d like a speci.. 2023. 11. 20.
[Nanografi] Carbon Nanotubes Thermal Radiation Coating Dispersion [Nanografi] Carbon Nanotubes Thermal Radiation Coating Dispersion SKU:NG02CN0124 Technical Properties: Film-forming Resin Coating Waterborne Polyurethane CNT Content 4 wt% Paint Dry Condition (°C) 75-85 Recommended Coating Thickness (um) 5.0-10.0 Emissivity Coating (%) 0.96-0.98 Coating Surface Resistivity (Ω) 104-106 Thermal Conductivity (W/m.K) 1.4-2.0 Coating Hardness HB Coating adhesion (lev.. 2023. 11. 17.
[Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag SKU: P2020-017 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 80% as determined by SDS-PAGE Sequence Information Species: Homo sapiens, human Tags: Avi/His-Tag, C-terminal Sequence without tags (AA 20-707): MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEI.. 2023. 11. 16.
[ACS Material] Si/C Composite Anode Material [ACS Material] Si/C Composite Anode Material SKU# BASCA011 Type: Type A Type B Appearance: Black grey powder Black grey powder Si Content (wt%): ~8 ~18 Particle Size (D50) (μm): 15.9 15.7 Real Density (g/cm3): 2.26 2.26 Tap Density (g/cm3): 0.95 1.01 BET Surface Area (m2/g): 1.6 1.7 For Reference: Discharge Capacity (mAh/g): 449.2 546.3 First Discharge Efficiency (%): 87 85.7 Typical SEM Image o.. 2023. 11. 15.
[iCell Bioscience] Human Umbilical Vein Endothelial Cell cDNA HUVEC cDNA [iCell Bioscience] Human Umbilical Vein Endothelial Cell cDNA HUVEC cDNA Hum-iCell-1326D Size/Quantity: 20 reactions Availability: In stock HUVEC cDNA 20 reactions This Product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. Store at -20°C Dry ice. ScienCell Research Laboratories PCR-ready first strand cDNA is prepared f.. 2023. 11. 14.

티스토리툴바