분류 전체보기514 [LabBioreagents] Adalimumab ELISA Kit [LabBioreagents] Adalimumab ELISA KitCatalog No.: AEK-01-1220Adalimumab (Human) ELISA KitCatalog Number: AEK-01-1220Size: 1 plate (96 wells)Adalimumab ELISA Kit is a sandwich enzyme-linked immunoassay for the quantitative determination of Adaliumab with high sensitivity and specificity in serum and plasma.Kit PerformanceSensitivity: 25 ng/mLAssay Range: 25 – 2000 ng/mLCross-reactivity: There is .. 2025. 1. 2. [Membrane Solutions] Nylon Mesh Filter [Membrane Solutions] Nylon Mesh FilterDescription:Nylon Mesh Filter, Size:25mm, Pore Size:30μmPackaging:200(pcs)#MembraneSolutions #NylonMeshFilter #MeshFilter 2025. 1. 2. [Calixar] Ion Channels [Calixar] Ion ChannelsTargetDescription hKCC2CALIXAR’s Solute carrier family 12 member 5 (hKCC2) facilitates reliable fragment-based drug design (FBDD), structure-based drug discovery (SBDD), and antibody discovery against this specific target. Product highlights High Purity: Our products are rigorously purified and quality-controlled to meet the highest standards. Biological Activity: We provi.. 2024. 12. 30. [CellPro] CyrunFeh® Separating gel coagulation tube [CellPro] CyrunFeh® Separating gel coagulation tubeProduct TypeItem No.Additives TypeSpecifications (Suction Volume)Pipe body sizeHead cover colorPackagingSeparating gel coagulation tube340135coagulant separating gel3.5mL13X75mmDark yellow100 PCs/pallet, 1000 PCs/carton340150coagulant separating gel5.0mL13X100mmDark yellow100 PCs/pallet, 1000 PCs/carton CellProBio Separating gel coagulation tube.. 2024. 12. 28. [GlycoNZ] GlcAβ-sp3-biot [GlycoNZ] GlcAβ-sp3-biot 0012-BMGlcAβ-C3-biotβ-glucuronate-BMBM-SeriesMonosaccharideMonomeric 2024. 12. 23. [InRedox] ATO Films on Ti Foil [InRedox] ATO Films on Ti FoilSKU: AAOThe general range of AAO geometries and specifications for our standard stock products.ParameterAvailable Range *Standard Specifications (stock products)Nanotube Diameter, nm15 – 75050, 100, 150, 300, 500 (±10% + 2)Size, mm (in)5 – 200 (1/8″ – 8″)10 mm and 25 mm OD round; 10 mm x 10 mm and 25 mm x 25 mm squareShapeanyround or square ATO Thickness (Nanotube .. 2024. 12. 18. [UbiQ] Ub-FP [UbiQ] Ub-FPcode UbiQ-012Category activity assay reagents UbiQ-012 (Ub-FP) is a fluorescence polarization assay reagent which is based on a 5-carboxytetramethylrhodamine (TAMRA) modified Lys-Gly sequence that is linked to ubiquitin via a native isopeptide bond with the lysine side-chain. Typical substrate concentrations range from 10−100 nM. DUB concentrations can range from 0.01-10 nM but depe.. 2024. 12. 17. [ACS Material] Double-Pass AAO (5p/Pack) [ACS Material] Double-Pass AAO (5p/Pack)SKU# A2010011 CAS No.: 1344-28-1Types of Double-Pass AAO TemplatesSKUApertureHole DepthHole Cycle(Interpore distance)Circular (DIA)A201001150nm50-70µm110nm1.2 cmA202001170nm50-70µm110nm1.2 cmA203001190nm50-70µm110nm1.2 cmA2041011200nm50-70µm450nm1.2 cmA2051011300nm50-70µm450nm1.2 cmA2061011400nm50-70µm450nm1.2 cmA201002150nm50-70µm110nm2.5 cmA202002170nm50.. 2024. 12. 16. [Trenzyme] PowerNuclease, His-Tag [Trenzyme] PowerNuclease, His-TagSKU: P2020-176_100 Product Name: PowerNuclease, His-TagCatalog No.: P2020-176RefSeq Links: WP_015377376.1; NZ_WVHX01000034.1; PDBe 4e3y; UniProt: P13717Synonyms: Nuclease, Endonuclease, Benzonase® Species: Serratia marcescensTags: His-tag, N-terminalSequence without tags (AA 22-266):MDTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN.. 2024. 12. 10. [Syringa lab Supplies] Falcon Centrifuge Tubes 15 mL with Cross-Cut Septa Caps [Syringa lab Supplies] Falcon Centrifuge Tubes 15 mL with Cross-Cut Septa CapsSKU:1F711 15 mL Cross Cut SeptaSecure non-PTFE septa caps with Falcon Centrifuge Tubes, Pack of 25 (non-sterile)Product OverviewIntroducing the 15 mL Falcon Centrifuge Tubes with SeptaSecure caps. This pack of 25 non-sterile Falcon Tubes is perfectly sized for smaller volume requirements and offers the same innovative .. 2024. 12. 4. [Reed Biotech] EYFP Rabbit Polyclonal Antibody [Reed Biotech] EYFP Rabbit Polyclonal Antibody Catalog Number:RA20406 Product NameEYFP Rabbit Polyclonal AntibodySpeciesN/AApplicationsWB, IHC, IF, IPConditionPBS, pH 7.4, containing 0.02% sodium azide as Preservative and 50% Glycerol.Alternative NamesYellow florescent protein, Enhanced Yellow florescent protein, EYFP, YFPStore-20°C. Do not aliquot the antibody.Recommended dilutionsWB: 1:3,000.. 2024. 11. 29. [CellPro] CellProBio 15ml 50ml Polypropylene Centrifuge Tubes [CellPro] CellProBio 15ml 50ml Polypropylene Centrifuge TubesSpecifications:P/NCapacityTube ColorDescriptionConfiguration80115115 mLClearBulk, Sterile25 tubes/pack, 20 packs/case801152P0115 mLClearRack Packed, Sterile25 tubes/rack, 20 racks/case80115615 mLAmberBulk, Sterile25 tubes/pack, 20 packs/case80150150 mLClearBulk, Sterile25 tubes/pack, 20 packs/case801502P0150 mLClearRack Packed, Sterile.. 2024. 11. 27. 이전 1 2 3 4 5 6 7 8 ··· 43 다음