전체 글514 [Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag SKU: P2020-017 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 80% as determined by SDS-PAGE Sequence Information Species: Homo sapiens, human Tags: Avi/His-Tag, C-terminal Sequence without tags (AA 20-707): MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEI.. 2023. 11. 16. [ACS Material] Si/C Composite Anode Material [ACS Material] Si/C Composite Anode Material SKU# BASCA011 Type: Type A Type B Appearance: Black grey powder Black grey powder Si Content (wt%): ~8 ~18 Particle Size (D50) (μm): 15.9 15.7 Real Density (g/cm3): 2.26 2.26 Tap Density (g/cm3): 0.95 1.01 BET Surface Area (m2/g): 1.6 1.7 For Reference: Discharge Capacity (mAh/g): 449.2 546.3 First Discharge Efficiency (%): 87 85.7 Typical SEM Image o.. 2023. 11. 15. [iCell Bioscience] Human Umbilical Vein Endothelial Cell cDNA HUVEC cDNA [iCell Bioscience] Human Umbilical Vein Endothelial Cell cDNA HUVEC cDNA Hum-iCell-1326D Size/Quantity: 20 reactions Availability: In stock HUVEC cDNA 20 reactions This Product is for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. Store at -20°C Dry ice. ScienCell Research Laboratories PCR-ready first strand cDNA is prepared f.. 2023. 11. 14. [Biocomma] Copure® MS 96-Well Solid Phase Extraction (SPE) Plates [Biocomma] Copure® MS 96-Well Solid Phase Extraction (SPE) Plates free 96-Well Plate MHLB9603 Copure® MS HLB 96-well plate 3mg/600μL 1 PC/PK MHLB9605 Copure® MS HLB 96-well plate 5 mg/600μL 1 PC/PK MWAX9603 Copure® MS WAX 96-well plate 3 mg/600μL 1 PC/PK MWAX9605 Copure® MS WAX 96-well plate 5 mg/600μL 1 PC/PK MWCX9603 Copure® MS WCX 96-well plate 3 mg/600μL 1 PC/PK MWCX9605 Copure® MS WCX 96-we.. 2023. 11. 13. [Iris Biotech] Boc-4-Abz-OH [Iris Biotech] Boc-4-Abz-OH Product code:BAA1330 CAS No.:66493-39-8 Formula:C12H15NO4 Molecular weight:237,25 g/mol Chemical name: 4-(t-Butyloxycarbonylamino)-benzoic acid 2023. 11. 10. [ACS Material] Copper Nanowire (50-200nm), 1g [ACS Material] Copper Nanowire (50-200nm), 1g SKU# NWCUE101 KEY FEATURES OF THE COPPER NANOWIRE: Product Name: Copper Nanowire Appearance: Red suspension Diameter: 50-200 nm Length: 10-30 µm Concentration: ~10 mg/ml Solution: Ethanol/Water* Purity: ~99% *ACS can also provide it in water dispersion. Contact us for more information. SEM Image of Copper Nanowire -- ACS Material SEM Image of Copper .. 2023. 11. 8. [Technistro] Silicon Dioxide Nanoparticles [Technistro] Silicon Dioxide Nanoparticles Product Name – Silicon Dioxide Nanoparticles (TI-SiO2) Purity – 99.9% Average Particle Size: 20-50 nm SSA: ~220 m2/g Molecular Weight: 231.533 g/mol Molecular Formula: SiO2 Bulk Density: 0.25 g/cm 3 Physical Form: Powder Morphology : Spherical Colour: White CAS No. : 7631-86-9 Available Size : 100gm | 500gm | 1kg Silicon Dioxide Nanoparticles Descriptio.. 2023. 11. 7. [Iris Biotech] AX14596 [Iris Biotech] AX14596 Product code:LS-4070 (1mg) CAS No.:655247-75-9 Formula:C18H18ClFN4O2 Molecular weight:376,81 g/mol Chemical name: [6-(3-Amino-propoxy)-7-methoxy-quinazolin-4-yl]-(3-chloro-4-fluoro-phenyl)-amine 2023. 11. 6. [Nanografi] Graphene Sheet, Size: 10 cm x 10 cm, Thickness: 35 µm, Highly Conductive [Nanografi] Graphene Sheet, Size: 10 cm x 10 cm, Thickness: 35 µm, Highly Conductive SKU:NG01GS0104 Graphene Sheet Size: 10 cm x 10 cm, Highly Conductive, Thickness: 35 µm Graphene sheets are essentially the finest materials in the world. Graphene sheet is a one-atom-thick planar sheet of carbon iotas which are intensively packed in a hexagonal lattice structure. Graphene sheets show high electr.. 2023. 11. 3. [ACS Material] Silicon nanoparticles [ACS Material] Silicon nanoparticles SKU# BASIB001 CAS No.: 7440-21-3 1. Preparation Method Chemical Vapor Deposition (CVD) Method 2. Characterizations Type: A-Discontinued B C Atomic Weight (g/mol): 28.08 28.08 28.08 Morphology: Spherical powder Spherical powder Spherical powder Average Particle Size (nm): 3 15 30 Spherical rate (%): 100 100 100 Purity (%): >99.99 >99.99 >99.99 BET Surface Area.. 2023. 11. 2. [Syringe Lab Supplies] 1J720: 15 mL Uncut Caps Only [Syringe Lab Supplies] 1J720: 15 mL Uncut Caps Only SKU: 1J720 15 mL UnCut SeptaSecure, Caps Only, Pack of 25 (non-sterile) 2023. 11. 2. [ACS Material] V-Shape AAO (5P/Pack) [ACS Material] V-Shape AAO (5P/Pack) SKU# A3010021 CAS No.: 1344-28-1 Types of V-Shape AAO Templates SKU Opening Aperture Bottom Aperture Hole Depth Size A3010021 90nm 40nm 200nm 2cm x 2cm A3030021 300nm 100nm 300nm 2cm x 2cm A3010011 90nm 40nm 200nm 1cm x 1cm A3030011 300nm 100nm 300nm 1cm x 1cm The tapered hole (V) AAO template changes the normal vertical channel AAO template into a structure .. 2023. 11. 1. 이전 1 ··· 11 12 13 14 15 16 17 ··· 43 다음