[Biofargo] Recombinant CXCL13,Swine,AF
Key features and details:
- Expression System:scherichia coli
- Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:is-tag at the N-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
CXCL13, also known as BCA-1 (B Cell-Attracting chemokine 1) or BLC, , is a recently identified new CXC chemokines. This chemokine is expressed in the stomach, spleen, liver, appendix and lymph nodes. CXCL13 can only elicit its activities through CXCR5receptor. BCA-1/BLC is a potent chemoattractant for B lymphocytes, and induces weak chemotactic response in T cells and macrophages. It should be noticed that CXCL13 shows no activity on neutrophils and monocytes.
Protein Accession:A0A4X1SVT8
Gene ID:100524265
Species:Swine
Expression Sequence:
VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA with polyhistidine tag at the N-terminus.
Activity:
N/A
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:10.81 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:swine CXCL13
'Biofargo' 카테고리의 다른 글
[Biofargo] GF20 MSC Xeno-Free SFM-SuperCulture™ (0) | 2024.04.29 |
---|---|
[Biofargo] Recombinant Human PDGF-BB Protein-T&L (0) | 2024.01.24 |
[Biofargo] Stem cells fetal bovine serum, Volume 500ml, U512-001 (0) | 2024.01.08 |