본문 바로가기

trenzyme9

[Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme]  Biotinylated hACE2 Protein (ECD), Avi/His-TagSKU: P2020-017Product Name: Biotinylated hACE2 Protein (ECD), Avi/His-TagCatalog No.: P2020-017RefSeq Links: UniProt: Q9BYF1Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting enzyme homolog; Metalloprotease MPROT15; biotinylated hACE2Expression Host: human, HEK293Formulation: .. 2024. 5. 29.
[Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated [Trenzyme] hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated SKU: P2020-037 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 90% as determined by SDS-PAGE Product Name: hACE2 Protein (ECD), Avi/His-Tag, non-biotinylated Catalog No.: P2020-037 RefSeq Links: UniProt: Q9BYF1 Synonyms: hACE2; ACEH; human angiotensin-converting enzyme 2; A.. 2024. 2. 21.
[Trenzyme] CHO-K1 human XCR1 [Trenzyme] CHO-K1 human XCR1 SKU: C2021-002 Product Name: CHO-K1 human XCR1 Catalog No.: C2021-002 Tube Label: CHO-K1 stably expressing hXCR1 Target: human XCR1 Parental Cell Line: CHO-K1 Organism: C. griseus Tissue: ovary Morphology: epithelial-like Mycoplasma Test: negative (provided by Eurofins Genomics) Biosafety Level: 1 Culture properties: adherent 2024. 1. 15.
[Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag [Trenzyme] Biotinylated hACE2 Protein (ECD), Avi/His-Tag SKU: P2020-017 Expression Host: human, HEK293 Formulation: PBS, pH 7,4 Format: Liquid, stored and shipped at -80°C Purity: > 80% as determined by SDS-PAGE Sequence Information Species: Homo sapiens, human Tags: Avi/His-Tag, C-terminal Sequence without tags (AA 20-707): MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEI.. 2023. 11. 16.
[Trenzyme] pro-TGF-beta 1, GFP/His-Tag SKU: P2020-118 Product Name: pro-TGF-beta 1, GFP/His-Tag Catalog No.: P2020-118 RefSeq Links: UniProt: P01137; NP_000651.3; NM_000660.6; PDB: 1KLA Synonyms: Latent TGF‑β1, small latent TGF-β1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-β1 Expression Host: human, HEK293 Formulation: PBS; pH 7.4. Format: Liquid, stored a.. 2023. 10. 13.
[Trenzyme] B7-H3 Protein, Human [Trenzyme] B7-H3 Protein, Human Product Name: B7-H3 Protein, Human Catalog No.: P2020-002 RefSeq Links: UniProt: Q5ZPR3-2 Synonyms: B7-H3 Protein, Human; B7H3 Protein, Human; B7RP-2 Protein; CD276 Recombinant protein containing the extracellular domain (ECD) of human CD276, Isoform 2 with C-terminal His-Tag. 2023. 9. 7.
[trenzyme] HEK-F Orco M.musculus Lactadherin [trenzyme] HEK-F Orco M.musculus Lactadherin SKU: C2021-005 Overview Product Name: HEK-F Orco M.musculus Lactadherin Catalog No.: C2021-005 Tube Label: HEK-F stably expressing Mfge8-D89 Product Information Target: M. musculus Lactadherin (uniprot P21956), D89E linker, C-terminal His-tag Parental Cell Line: HEK-F Organism: H. sapiens Tissue: embryonal kidney Mycoplasma Test: negative (provided by.. 2023. 8. 28.
[Trenzyme] hGuanylatekinase, His-Tag [Trenzyme] hGuanylatekinase, His-Tag SKU: P2020-107 Overview Product Name: hGuanylatekinase, His-Tag Catalog No.: P2020-107 RefSeq Links: UniProt: Q16774 Synonyms: guanosine monophosphate kinase; GMK; GMPK; Guanylate kinase; GUK1; hGMPK; human Guanylate kinase; GMP Kinase The transformation process of cellular guanosine monophosphate kinase (GMP) into guanosine monophosphate kinase (GDP) is perf.. 2023. 8. 21.
[Trenzyme] greenTEV Cleavage Kit [Trenzyme] greenTEV Cleavage Kit SKU: P2020-CK1 Including 1 x greenTEV (P2020-142) 1 x Cleavage and tag control protein (P2020-141) Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein. TEV cleavage results in two cleavage products of 42.8 kDa and 47.7 kDa. The optimized greenTEV protease and the Cleavage and tag contro.. 2023. 8. 18.

티스토리툴바